Blog

Remote work, jobs & careers

Guides, insights, and resources for remote job seekers.

Allremotejobsjobsearchengineeringautoapplyaitrainingjobscareeradvicedatasalaryremotestackeuroperlhflatamafricajobautomationasiaoutlierskillscomparisonbeginnerjobboardsaijobsearchaiatstoolfutureofworkworkfromhomemarketingmicro1work from anywheremachinelearningdataannotationnoexperiencelinkedinasync friendlyno experiencedesignsalescustomerservicesupportdevopsbackendjobmarketburnoutpricingreferralslistwritingscaleaiproductproductivitycontentresumeoperationsfrontendcoverletteraiagent2026easyapplyghostjobsnetworkingentry levelmid levelaccount executiverecruitersales development repcryptogrowthweb3blockchaincloudawsappenmindriftfintechalignerranalyticsindiahruxaccountexecutivefinancescamqualityfounderstoryweworkremotelyremotivejobcopilotloopcv
33 posts tagged aitrainingjobs
How to Get Hired on micro1: AI Interview, Pay and Tips
aitrainingjobsmicro1remotejobs

How to Get Hired on micro1: AI Interview, Pay and Tips

How micro1 hiring works in 2026: the scored AI interview, the assessment, typical hourly pay by domain, and why most applicants stall after signing up.

Sep 24, 2026· 7 min read
micro1 AI review: is it legit, and what does it actually pay in 2026?
aitrainingjobsmicro1

micro1 AI review: is it legit, and what does it actually pay in 2026?

Sep 24, 2026· 7 min
Does micro1 hire from your country? Remote eligibility explained
aitrainingjobsmicro1

Does micro1 hire from your country? Remote eligibility explained

Sep 24, 2026· 7 min
micro1 vs Mercor: which pays better for domain-expert AI work?
aitrainingjobsmicro1

micro1 vs Mercor: which pays better for domain-expert AI work?

Sep 24, 2026· 7 min
micro1 vs Outlier.ai: which AI training platform pays more?
aitrainingjobsmicro1

micro1 vs Outlier.ai: which AI training platform pays more?

Sep 24, 2026· 7 min
Remote AI Feedback Jobs in 2026: What They Are and How to Get One ($15-$60/hr)
aitrainingjobsrlhf

Remote AI Feedback Jobs in 2026: What They Are and How to Get One ($15-$60/hr)

Jul 12, 2026· 8 min
Appen Jobs in 2026: How to Apply, What Tasks Pay and Is It Worth It?
appenaitrainingjobs

Appen Jobs in 2026: How to Apply, What Tasks Pay and Is It Worth It?

Jul 12, 2026· 8 min
How to Pass the Outlier.ai Assessment in 2026 (Most People Fail the First Try)
outlieraitrainingjobs

How to Pass the Outlier.ai Assessment in 2026 (Most People Fail the First Try)

Jul 12, 2026· 9 min
Outlier.ai Pay Rate in 2026: What You'll Actually Earn (Not the Advertised $200/hr)
outlieraitrainingjobs

Outlier.ai Pay Rate in 2026: What You'll Actually Earn (Not the Advertised $200/hr)

Jul 12, 2026· 7 min
RLHF Jobs in 2026: What They Are, What They Pay ($15-$200/hr) and Where to Find Them
rlhfaitrainingjobs

RLHF Jobs in 2026: What They Are, What They Pay ($15-$200/hr) and Where to Find Them

Jul 12, 2026· 8 min
AI Training Jobs Pay Per Hour in 2026: The Honest Numbers ($3-$200/hr)
aitrainingjobssalary

AI Training Jobs Pay Per Hour in 2026: The Honest Numbers ($3-$200/hr)

Jul 7, 2026· 7 min
Best AI Training Platform for Beginners in 2026 (No Experience? Start Here)
aitrainingjobsbeginner

Best AI Training Platform for Beginners in 2026 (No Experience? Start Here)

Jul 7, 2026· 8 min
Best AI Training Platform for Coders in 2026 (Up to $200/hr, Here's How)
aitrainingjobsengineering

Best AI Training Platform for Coders in 2026 (Up to $200/hr, Here's How)

Jul 7, 2026· 8 min
Outlier.ai vs Mindrift for Writers: Which Pays More in 2026? ($14-$50/hr)
outliermindrift

Outlier.ai vs Mindrift for Writers: Which Pays More in 2026? ($14-$50/hr)

Jul 7, 2026· 7 min
Scale AI Jobs in 2026: Roles, Pay and How to Get Accepted
scaleaiaitrainingjobs

Scale AI Jobs in 2026: Roles, Pay and How to Get Accepted

Jul 7, 2026· 10 min
Alignerr Jobs in 2026: Is It Worth It? ($14-$30/hr Honest Review)
alignerraitrainingjobs

Alignerr Jobs in 2026: Is It Worth It? ($14-$30/hr Honest Review)

Jun 28, 2026· 7 min
DataAnnotation vs Appen: Which Is Better in 2026? (Honest Comparison)
dataannotationappen

DataAnnotation vs Appen: Which Is Better in 2026? (Honest Comparison)

Jun 28, 2026· 8 min
Get Paid to Train AI in 2026: Every Platform, Every Pay Rate ($3-$200/hr)
aitrainingjobsrlhf

Get Paid to Train AI in 2026: Every Platform, Every Pay Rate ($3-$200/hr)

Jun 28, 2026· 8 min
Outlier.ai Jobs in 2026: How to Apply, What It Pays and What to Expect
outlieraitrainingjobs

Outlier.ai Jobs in 2026: How to Apply, What It Pays and What to Expect

Jun 28, 2026· 8 min
Outlier.ai vs Scale AI: Which Pays More in 2026? ($15-$65/hr Compared)
outlierscaleai

Outlier.ai vs Scale AI: Which Pays More in 2026? ($15-$65/hr Compared)

Jun 28, 2026· 8 min
Remote Data Annotation Jobs in 2026: Platforms, Pay and How to Start ($10-$50/hr)
dataannotationaitrainingjobs

Remote Data Annotation Jobs in 2026: Platforms, Pay and How to Start ($10-$50/hr)

Jun 25, 2026· 9 min
DataAnnotation.tech Jobs in 2026: How to Get In and What It Actually Pays
dataannotationaitrainingjobs

DataAnnotation.tech Jobs in 2026: How to Get In and What It Actually Pays

Jun 25, 2026· 8 min
Mindrift Jobs in 2026: Creative AI Training Work. Is It Worth It? ($15-$40/hr)
mindriftaitrainingjobs

Mindrift Jobs in 2026: Creative AI Training Work. Is It Worth It? ($15-$40/hr)

Jun 25, 2026· 9 min
How to Get Your First AI Training Job With Zero Experience
aitrainingjobsnoexperience

How to Get Your First AI Training Job With Zero Experience

May 15, 2026· 8 min
AI Training Jobs Outside the US: Which Platforms Actually Pay Cash?
aitrainingjobsinternational

AI Training Jobs Outside the US: Which Platforms Actually Pay Cash?

May 15, 2026· 8 min
Are AI Training Jobs Legit or a Scam? Here's How to Tell
aitrainingjobsscam

Are AI Training Jobs Legit or a Scam? Here's How to Tell

May 15, 2026· 8 min
Best AI Training Platforms Ranked in 2026 (Honest, No Fluff)
aitrainingjobsplatforms

Best AI Training Platforms Ranked in 2026 (Honest, No Fluff)

May 15, 2026· 8 min
Can You Make a Full-Time Income From AI Training Work?
aitrainingjobsincome

Can You Make a Full-Time Income From AI Training Work?

May 15, 2026· 8 min
How Do AI Training Jobs Actually Work? RLHF Explained Simply
aitrainingjobsrlhf

How Do AI Training Jobs Actually Work? RLHF Explained Simply

May 15, 2026· 8 min
How Much Do AI Training Jobs Actually Pay in 2026?
aitrainingjobssalary

How Much Do AI Training Jobs Actually Pay in 2026?

May 15, 2026· 8 min
Outlier.ai vs Alignerr: Which Is Easier to Get Into?
outlieralignerr

Outlier.ai vs Alignerr: Which Is Easier to Get Into?

May 15, 2026· 7 min
Data Annotation vs Outlier: Which Pays More? ($20-$200/hr)
outlierdataannotation

Data Annotation vs Outlier: Which Pays More? ($20-$200/hr)

May 15, 2026· 7 min
What Are AI Training Jobs? A Beginner's Guide for 2026
aitrainingjobsrlhf

What Are AI Training Jobs? A Beginner's Guide for 2026

May 15, 2026· 7 min
Posts tagged "aitrainingjobs" — RemoteStack Blog